PDB entry 1irp

View 1irp on RCSB PDB site
Description: solution structure of human interleukin-1 receptor antagonist protein
Class: cytokine
Keywords: cytokine
Deposited on 1994-10-18, released 1995-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 receptor antagonist
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1irpa1, d1irpa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1irpA (A:)
mrpsgrksskmqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflg
ihggkmclscvksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgw
flctameadqpvsltnmpdegvmvtkfyfqede