PDB entry 1irm

View 1irm on RCSB PDB site
Description: Crystal structure of apo heme oxygenase-1
Class: oxidoreductase
Keywords: disordered alpha helix, apo form of hemoprotein, OXIDOREDUCTASE
Deposited on 2001-10-09, released 2002-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.202
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apo heme oxygenase-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irma_
  • Chain 'B':
    Compound: apo heme oxygenase-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irmb_
  • Chain 'C':
    Compound: apo heme oxygenase-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irmc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1irmA (A:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irmA (A:)
    sefmrnfqkgqvsregfklvmaslyhiytaleeeiernkqnpvyaplyfpeelhrraale
    qdmafwygphwqeaipytpatqhyvkrlhevggthpellvahaytrylgdlsggqvlkki
    aqkamalpssgeglafftfpsidnptkfkqlyrarmntlemtpevkhrvteeaktaflln
    ielfeelqallt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1irmB (B:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irmB (B:)
    nsefmrnfqkgqvsregfklvmaslyhiytaleeeiernkqnpvyaplyfpeelhrraal
    eqdmafwygphwqeaipytpatqhyvkrlhevggthpellvahaytrylgdlsqvlkkia
    qkamalpssgeglafftfpsidnptkfkqlyrarmntlemtpevkhrvteeaktafllni
    elfeelqallte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1irmC (C:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irmC (C:)
    nsefmrnfqkgqvsregfklvmaslyhiytaleeeiernkqnpvyaplyfpeelhrraal
    eqdmafwygphwqeaipytpatqhyvkrlhevggthpellvahaytrylgdlsggqvlkk
    iaqkamalpssgeglafftfpsidnptkfkqlyrarmntlemtpevkhrvteeaktafll
    nielfeelqallteeh