PDB entry 1irl

View 1irl on RCSB PDB site
Description: the solution structure of the f42a mutant of human interleukin 2
Class: cytokine
Keywords: cytokine
Deposited on 1995-08-25, released 1995-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60568 (0-132)
    • engineered (41)
  Domains in SCOPe 2.06: d1irla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1irlA (A:)
  aptssstkktqlqlehllldlqmilnginnyknpkltrmltakfympkkatelkhlqcle
  eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
  witfcqsiistlt