PDB entry 1irl

View 1irl on RCSB PDB site
Description: the solution structure of the f42a mutant of human interleukin 2
Class: cytokine
Keywords: cytokine
Deposited on 1995-08-25, released 1995-12-07
The last revision prior to the SCOP 1.73 freeze date was dated 1995-12-07, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60568 (0-132)
      • engineered (41)
    Domains in SCOP 1.73: d1irla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1irlA (A:)
    aptssstkktqlqlehllldlqmilnginnyknpkltrmltakfympkkatelkhlqcle
    eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
    witfcqsiistlt