PDB entry 1irl

View 1irl on RCSB PDB site
Description: the solution structure of the f42a mutant of human interleukin 2
Deposited on 1995-08-25, released 1995-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1irl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1irl_ (-)
    aptssstkktqlqlehllldlqmilnginnyknpkltrmltakfympkkatelkhlqcle
    eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
    witfcqsiistlt