PDB entry 1irk

View 1irk on RCSB PDB site
Description: crystal structure of the tyrosine kinase domain of the human insulin receptor
Deposited on 1995-01-02, released 1995-02-27
The last revision prior to the SCOP 1.67 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1irk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1irk_ (-)
    vfpssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irk_ (-)
    ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre
    rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg
    rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet
    dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk
    fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse
    enk