PDB entry 1irj

View 1irj on RCSB PDB site
Description: Crystal Structure of the MRP14 complexed with CHAPS
Class: metal binding protein
Keywords: Calgranulin B, MRP14, S100A9, EF-hand, METAL BINDING PROTEIN
Deposited on 2001-10-09, released 2002-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.245
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Migration Inhibitory Factor-Related Protein 14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irja_
  • Chain 'B':
    Compound: Migration Inhibitory Factor-Related Protein 14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irjb_
  • Chain 'C':
    Compound: Migration Inhibitory Factor-Related Protein 14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irjc_
  • Chain 'D':
    Compound: Migration Inhibitory Factor-Related Protein 14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irjd_
  • Chain 'E':
    Compound: Migration Inhibitory Factor-Related Protein 14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irje_
  • Chain 'F':
    Compound: Migration Inhibitory Factor-Related Protein 14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irjf_
  • Chain 'G':
    Compound: Migration Inhibitory Factor-Related Protein 14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irjg_
  • Chain 'H':
    Compound: Migration Inhibitory Factor-Related Protein 14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irjh_
  • Heterogens: CA, CPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1irjA (A:)
    tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irjA (A:)
    tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1irjB (B:)
    tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irjB (B:)
    ckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehi
    medldtnadkqlsfeefimlmarl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1irjC (C:)
    tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irjC (C:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1irjD (D:)
    tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irjD (D:)
    msqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehime
    dldtnadkqlsfeefimlmarl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1irjE (E:)
    tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irjE (E:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1irjF (F:)
    tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irjF (F:)
    ckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehi
    medldtnadkqlsfeefimlmarl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1irjG (G:)
    tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irjG (G:)
    ckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehi
    medldtnadkqlsfeefimlmarl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1irjH (H:)
    tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irjH (H:)
    tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarl