PDB entry 1iri

View 1iri on RCSB PDB site
Description: Crystal structure of human autocrine motility factor complexed with an inhibitor
Deposited on 2001-10-08, released 2002-06-05
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-05, with a file datestamp of 2002-06-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1iria_
  • Chain 'B':
    Domains in SCOP 1.61: d1irib_
  • Chain 'C':
    Domains in SCOP 1.61: d1iric_
  • Chain 'D':
    Domains in SCOP 1.61: d1irid_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iriA (A:)
    maaltrdpqfqklqqwyrehrselnlrrlfdankdrfnhfsltlntnhghilvdysknlv
    tedvmrmlvdlaksrgveaarermfngekinytegravlhvalrnrsntpilvdgkdvmp
    evnkvldkmksfcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggpr
    vwyvsnidgthiaktlaqlnpesslfiiasktfttqetitnaetakewflqaakdpsava
    khfvalstnttkvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsga
    hwmdqhfrttpleknapvllallgiwyincfgcethamlpydqylhrfaayfqqgdmesn
    gkyitksgtrvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
    hhkillanflaqtealmrgksteearkelqaagkspedlerllphkvfegnrptnsivft
    kltpfmlgalvamyehkifvqgiiwdinsfdqwgvelgkqlakkiepeldgsaqvtshda
    stnglinfikqqrearv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iriB (B:)
    maaltrdpqfqklqqwyrehrselnlrrlfdankdrfnhfsltlntnhghilvdysknlv
    tedvmrmlvdlaksrgveaarermfngekinytegravlhvalrnrsntpilvdgkdvmp
    evnkvldkmksfcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggpr
    vwyvsnidgthiaktlaqlnpesslfiiasktfttqetitnaetakewflqaakdpsava
    khfvalstnttkvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsga
    hwmdqhfrttpleknapvllallgiwyincfgcethamlpydqylhrfaayfqqgdmesn
    gkyitksgtrvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
    hhkillanflaqtealmrgksteearkelqaagkspedlerllphkvfegnrptnsivft
    kltpfmlgalvamyehkifvqgiiwdinsfdqwgvelgkqlakkiepeldgsaqvtshda
    stnglinfikqqrearv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iriC (C:)
    maaltrdpqfqklqqwyrehrselnlrrlfdankdrfnhfsltlntnhghilvdysknlv
    tedvmrmlvdlaksrgveaarermfngekinytegravlhvalrnrsntpilvdgkdvmp
    evnkvldkmksfcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggpr
    vwyvsnidgthiaktlaqlnpesslfiiasktfttqetitnaetakewflqaakdpsava
    khfvalstnttkvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsga
    hwmdqhfrttpleknapvllallgiwyincfgcethamlpydqylhrfaayfqqgdmesn
    gkyitksgtrvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
    hhkillanflaqtealmrgksteearkelqaagkspedlerllphkvfegnrptnsivft
    kltpfmlgalvamyehkifvqgiiwdinsfdqwgvelgkqlakkiepeldgsaqvtshda
    stnglinfikqqrearv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iriD (D:)
    maaltrdpqfqklqqwyrehrselnlrrlfdankdrfnhfsltlntnhghilvdysknlv
    tedvmrmlvdlaksrgveaarermfngekinytegravlhvalrnrsntpilvdgkdvmp
    evnkvldkmksfcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggpr
    vwyvsnidgthiaktlaqlnpesslfiiasktfttqetitnaetakewflqaakdpsava
    khfvalstnttkvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsga
    hwmdqhfrttpleknapvllallgiwyincfgcethamlpydqylhrfaayfqqgdmesn
    gkyitksgtrvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
    hhkillanflaqtealmrgksteearkelqaagkspedlerllphkvfegnrptnsivft
    kltpfmlgalvamyehkifvqgiiwdinsfdqwgvelgkqlakkiepeldgsaqvtshda
    stnglinfikqqrearv