PDB entry 1irh

View 1irh on RCSB PDB site
Description: the solution structure of the third kunitz domain of tissue factor pathway inhibitor
Deposited on 2001-10-02, released 2002-02-06
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1irha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1irhA (A:)
    efhgpswcltpadrglcranenrfyynsvigkcrpfkysgcggnennftskqeclrackk
    g