PDB entry 1ire

View 1ire on RCSB PDB site
Description: Crystal Structure of Co-type nitrile hydratase from Pseudonocardia thermophila
Deposited on 2001-10-01, released 2002-10-01
The last revision prior to the SCOP 1.69 freeze date was dated 2002-10-01, with a file datestamp of 2002-10-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1irea_
  • Chain 'B':
    Domains in SCOP 1.69: d1ireb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ireA (A:)
    mtenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvv
    kawtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlascypwpvlg
    lppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdg
    wseeelatlvtresmigvepakav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ireA (A:)
    tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
    awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlascypwpvlgl
    ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
    seeelatlvtresmigvepakav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ireB (B:)
    mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
    aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
    qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
    tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt