PDB entry 1irc

View 1irc on RCSB PDB site
Description: cysteine rich intestinal protein
Class: oxygen storage
Keywords: oxygen storage, respiratory protein, heme
Deposited on 1995-12-19, released 1996-07-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.177
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myoglobin (metaquo)
    Species: Physeter catodon [TaxId:9755]
    Gene: SPERM WHALE MYOGLOBIN SYNTHETI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-End)
      • engineered (93)
    Domains in SCOPe 2.05: d1irca_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ircA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqsgatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ircA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqsgatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyq