PDB entry 1ir8

View 1ir8 on RCSB PDB site
Description:
Deposited on 2001-09-19, released 2001-10-03
The last revision prior to the SCOP 1.63 freeze date was dated 2001-10-03, with a file datestamp of 2001-10-03.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.166
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ir8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir8A (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqmns
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl