PDB entry 1ir3

View 1ir3 on RCSB PDB site
Description: phosphorylated insulin receptor tyrosine kinase in complex with peptide substrate and ATP analog
Class: complex (transferase/substrate)
Keywords: tyrosine kinase, signal transduction, phosphotransferase, complex (kinase/peptide substrate/ATP analog), enzyme, complex (transferase/substrate)
Deposited on 1997-09-22, released 1998-01-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-305)
      • engineered (3)
      • engineered (6)
      • modified residue (180)
      • modified residue (184-185)
    Domains in SCOPe 2.06: d1ir3a_
  • Chain 'B':
    Compound: peptide substrate
    Database cross-references and differences (RAF-indexed):
    • PDB 1IR3
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ir3A (A:)
    vfpssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir3A (A:)
    ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre
    rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg
    rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet
    dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk
    fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse
    enk
    

  • Chain 'B':
    No sequence available.