PDB entry 1ir1

View 1ir1 on RCSB PDB site
Description: Crystal Structure of Spinach Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase (Rubisco) Complexed with CO2, Mg2+ and 2-Carboxyarabinitol-1,5-Bisphosphate
Class: lyase
Keywords: alpha/beta barrel, lyase
Deposited on 2001-08-31, released 2002-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.155
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Large subunit of Rubisco
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • modified residue (200)
    Domains in SCOPe 2.07: d1ir1a1, d1ir1a2
  • Chain 'B':
    Compound: Large subunit of Rubisco
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • modified residue (200)
    Domains in SCOPe 2.07: d1ir1b1, d1ir1b2
  • Chain 'C':
    Compound: Large subunit of Rubisco
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • modified residue (200)
    Domains in SCOPe 2.07: d1ir1c1, d1ir1c2
  • Chain 'D':
    Compound: Large subunit of Rubisco
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • modified residue (200)
    Domains in SCOPe 2.07: d1ir1d1, d1ir1d2
  • Chain 'S':
    Compound: Small subunit of Rubisco
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • modified residue (0)
    Domains in SCOPe 2.07: d1ir1s_
  • Chain 'T':
    Compound: Small subunit of Rubisco
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • modified residue (0)
    Domains in SCOPe 2.07: d1ir1t_
  • Chain 'U':
    Compound: Small subunit of Rubisco
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • modified residue (0)
    Domains in SCOPe 2.07: d1ir1u_
  • Chain 'V':
    Compound: Small subunit of Rubisco
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • modified residue (0)
    Domains in SCOPe 2.07: d1ir1v_
  • Heterogens: MG, CAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ir1A (A:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir1A (A:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ir1B (B:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir1B (B:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ir1C (C:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir1C (C:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ir1D (D:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir1D (D:)
    efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
    dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmm
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvst
    pgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir1S (S:)
    mkvwptqnmkryetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrqvqcvsfiaykp
    agy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir1T (T:)
    mkvwptqnmkryetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrqvqcvsfiaykp
    agy
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir1U (U:)
    mkvwptqnmkryetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrqvqcvsfiaykp
    agy
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir1V (V:)
    mkvwptqnmkryetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrqvqcvsfiaykp
    agy