PDB entry 1ir0

View 1ir0 on RCSB PDB site
Description: oxidized [4fe-4s] ferredoxin from bacillus thermoproteolyticus (form ii)
Deposited on 2001-08-30, released 2002-02-13
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.112
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1ir0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ir0A (A:)
  pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
  cptdsikvadepfdgdpnkfe