PDB entry 1iqz

View 1iqz on RCSB PDB site
Description: oxidized [4fe-4s] ferredoxin from bacillus thermoproteolyticus (form i)
Deposited on 2001-08-30, released 2002-02-13
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.098
AEROSPACI score: 1.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1iqza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqzA (A:)
    pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
    cptdsikvadepfdgdpnkfe