PDB entry 1iqw

View 1iqw on RCSB PDB site
Description: crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a
Class: immune system
Keywords: immunoglobulin, fab, anti_fas, agonistic antibody, apoptosis, immune system
Deposited on 2001-08-10, released 2002-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.168
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody m-hfe7a, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IQW (0-End)
    Domains in SCOPe 2.06: d1iqwh1, d1iqwh2
  • Chain 'L':
    Compound: antibody m-hfe7a, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IQW (0-End)
    Domains in SCOPe 2.06: d1iqwl1, d1iqwl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1iqwH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
    nqkfkgkatltvdtssstaymqlssltsedsavyycarnrdysnnwyfdvwgtgttvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivprdcgckpcic
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqwH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
    nqkfkgkatltvdtssstaymqlssltsedsavyycarnrdysnnwyfdvwgtgttvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1iqwL (L:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedprtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqwL (L:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedprtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr