PDB entry 1iqv

View 1iqv on RCSB PDB site
Description: Crystal Structure Analysis of the archaebacterial ribosomal protein S7
Class: ribosome
Keywords: ribosomal protein, RNA-binding, decoding center, helix-turn-helix, ribosome
Deposited on 2001-08-07, released 2001-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s7
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1541
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iqvA (A:)
    mkevakplqerffipheikvmgrwstedvevkdpslkpyinleprllphthgrhakkhfg
    kanvhiverlinkvmrsggshykvaghfmrrehrslnskkvrayevvkeafkiiekrtgk
    npiqvlvwaienaapredttsvmfggiryhvavdisplrrldvalrnialgasakcyrtk
    msfaealaeeiilaankdpksyayskkleieriaessr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqvA (A:)
    ikvmgrwstedvevkdpslkpyinleprvhiverlinkvmrsggsskkvrayevvkeafk
    iiekrtgknpiqvlvwaienaapredttsvmfggiryhvavdisplrrldvalrnialga
    sakcyrtkmsfaealaeeiilaankdpksyayskkleieriaessr