PDB entry 1iqt

View 1iqt on RCSB PDB site
Description: solution structure of the c-terminal rna-binding domain of heterogeneous nuclear ribonucleoprotein d0 (auf1)
Deposited on 2001-08-01, released 2002-08-01
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-01, with a file datestamp of 2002-08-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1iqta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iqtA (A:)
  kifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkimek
  kyhnvglskceikva