PDB entry 1iqs

View 1iqs on RCSB PDB site
Description: Minimized average structure of MTH1880 from Methanobacterium Thermoautotrophicum
Class: metal binding protein
Keywords: alpha-beta, anti-parallel, METAL BINDING PROTEIN
Deposited on 2001-07-29, released 2002-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mth1880
  Species: Methanothermobacter thermautotrophicus [TaxId:145262]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27908 (0-87)
    • engineered (0)
  Domains in SCOPe 2.08: d1iqsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iqsA (A:)
  lfiatlkgiftlkdlpeefrpfvdykaglekkklsdddeiaiisikgtqsnhvlflssyn
  svdeirkeleeagakinhttlkileghl