PDB entry 1iqr

View 1iqr on RCSB PDB site
Description: Crystal structure of DNA photolyase from Thermus thermophilus
Deposited on 2001-07-27, released 2001-11-28
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-28, with a file datestamp of 2001-11-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqrA (A:)
    gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
    rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
    phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgeea
    alaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegarkw
    vaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamre
    lhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvda
    apyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlard