PDB entry 1iqq

View 1iqq on RCSB PDB site
Description: Crystal Structure of Japanese pear S3-RNase
Class: hydrolase
Keywords: pyrus pyrifolia, japanese pear, s-RNAse, self-incompatibility, t2 family ribonuclease, hydrolase
Deposited on 2001-07-25, released 2001-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.172
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S3-RNase
    Species: Pyrus pyrifolia [TaxId:3767]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iqqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqqA (A:)
    ydyfqftqqyqlavcnsnrtlckdppdklftvhglwpsnmvgpdpskcpiknirkrekll
    ehqleiiwpnvfdrtknnlfwdkewmkhgscgyptidnenhyfetvikmyiskkqnvsri
    lskakiepdgkkralldienairngadnkkpklkcqkkgtttelveitlcsdksgehfid
    cphpfepisphycptnniky