PDB entry 1iqq

View 1iqq on RCSB PDB site
Description: Crystal Structure of Japanese pear S3-RNase
Class: hydrolase
Keywords: pyrus pyrifolia, japanese pear, s-RNAse, self-incompatibility, t2 family ribonuclease, hydrolase
Deposited on 2001-07-25, released 2001-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.172
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: S3-RNase
  Species: Pyrus pyrifolia [TaxId:3767]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O80323 (0-199)
  Domains in SCOPe 2.06: d1iqqa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iqqA (A:)
  ydyfqftqqyqlavcnsnrtlckdppdklftvhglwpsnmvgpdpskcpiknirkrekll
  ehqleiiwpnvfdrtknnlfwdkewmkhgscgyptidnenhyfetvikmyiskkqnvsri
  lskakiepdgkkralldienairngadnkkpklkcqkkgtttelveitlcsdksgehfid
  cphpfepisphycptnniky