PDB entry 1iqq

View 1iqq on RCSB PDB site
Description: crystal structure of japanese pear s3-rnase
Deposited on 2001-07-25, released 2001-11-07
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-19, with a file datestamp of 2001-12-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.172
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1iqqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iqqA (A:)
ydyfqftqqyqlavcnsnrtlckdppdklftvhglwpsnmvgpdpskcpiknirkrekll
ehqleiiwpnvfdrtknnlfwdkewmkhgscgyptidnenhyfetvikmyiskkqnvsri
lskakiepdgkkralldienairngadnkkpklkcqkkgtttelveitlcsdksgehfid
cphpfepisphycptnniky