PDB entry 1iqp

View 1iqp on RCSB PDB site
Description: Crystal Structure of the Clamp Loader Small Subunit from Pyrococcus furiosus
Class: replication
Keywords: clamp loader, extended aaa-ATPase domain, complex with ADP, replication
Deposited on 2001-07-24, released 2001-09-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rfcs
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rfcs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqpa1, d1iqpa2
  • Chain 'B':
    Compound: rfcs
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rfcs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqpb1, d1iqpb2
  • Chain 'C':
    Compound: rfcs
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rfcs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqpc1, d1iqpc2
  • Chain 'D':
    Compound: rfcs
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rfcs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqpd1, d1iqpd2
  • Chain 'E':
    Compound: rfcs
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rfcs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqpe1, d1iqpe2
  • Chain 'F':
    Compound: rfcs
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rfcs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqpf1, d1iqpf2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iqpA (A:)
    mseeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkt
    taalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldead
    altqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlry
    iaeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedir
    emmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigey
    nfrlveganeiiqleallaqftligkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqpA (A:)
    seeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgktt
    aalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeada
    ltqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryi
    aeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedire
    mmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigeyn
    frlveganeiiqleallaqftligkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iqpB (B:)
    mseeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkt
    taalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldead
    altqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlry
    iaeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedir
    emmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigey
    nfrlveganeiiqleallaqftligkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqpB (B:)
    seeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgktt
    aalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeada
    ltqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryi
    aeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedire
    mmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigeyn
    frlveganeiiqleallaqftligkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iqpC (C:)
    mseeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkt
    taalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldead
    altqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlry
    iaeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedir
    emmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigey
    nfrlveganeiiqleallaqftligkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqpC (C:)
    kvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkttaalalar
    elfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeadaltqdaqq
    alrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryiaenegle
    lteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpediremmllalk
    gnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigeynfrlvega
    neiiqleallaqftligkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iqpD (D:)
    mseeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkt
    taalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldead
    altqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlry
    iaeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedir
    emmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigey
    nfrlveganeiiqleallaqftligkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqpD (D:)
    seeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgktt
    aalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeada
    ltqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryi
    aeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedire
    mmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigeyn
    frlveganeiiqleallaqftligkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1iqpE (E:)
    mseeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkt
    taalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldead
    altqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlry
    iaeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedir
    emmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigey
    nfrlveganeiiqleallaqftligkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqpE (E:)
    seeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgktt
    aalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeada
    ltqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryi
    aeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedire
    mmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigeyn
    frlveganeiiqleallaqftligkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1iqpF (F:)
    mseeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkt
    taalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldead
    altqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlry
    iaeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedir
    emmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigey
    nfrlveganeiiqleallaqftligkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqpF (F:)
    seeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgktt
    aalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeada
    ltqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryi
    aeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvasrarpedire
    mmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvlladkigeyn
    frlveganeiiqleallaqftligkk