PDB entry 1iqo

View 1iqo on RCSB PDB site
Description: Solution structure of MTH1880 from methanobacterium thermoautotrophicum
Class: metal binding protein
Keywords: beta-alpha, anti-parallel, calcium binding, structural genomics, METAL BINDING PROTEIN
Deposited on 2001-07-23, released 2002-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein mth1880
  Species: Methanothermobacter [TaxId:145260]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27908 (0-87)
    • engineered (0)
  Domains in SCOPe 2.08: d1iqoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iqoA (A:)
  lfiatlkgiftlkdlpeefrpfvdykaglekkklsdddeiaiisikgtqsnhvlflssyn
  svdeirkeleeagakinhttlkileghl