PDB entry 1iqd

View 1iqd on RCSB PDB site
Description: Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.
Class: immune system/blood clotting
Keywords: factor viii, c2 domain, antibody, blood coagulation, inhibitor, bo2c11, immune system/blood clotting complex
Deposited on 2001-07-21, released 2001-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human monoclonal bo2c11 fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IQD (0-210)
    Domains in SCOPe 2.03: d1iqda1, d1iqda2
  • Chain 'B':
    Compound: human monoclonal bo2c11 fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IQD (0-214)
    Domains in SCOPe 2.03: d1iqdb1, d1iqdb2
  • Chain 'C':
    Compound: human factor viii
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00451 (0-155)
      • engineered (122)
    Domains in SCOPe 2.03: d1iqdc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iqdA (A:)
    ialtqspgtlslspgeratlscrasqsfsssylawyqqkpgqaprlliygastratgipd
    rfsgsgsgtdftltisrlepedfavyycqkygtsaitfgqgtrleikgtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqdA (A:)
    ialtqspgtlslspgeratlscrasqsfsssylawyqqkpgqaprlliygastratgipd
    rfsgsgsgtdftltisrlepedfavyycqkygtsaitfgqgtrleikgtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglvtksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iqdB (B:)
    qvqlvqsgaevkkpgasvkvsckvsgytltelpvhwvrqapgkglewvgsfdpesgesiy
    arefqgsvtmtadtstniaymelsslrsddtavyycavpdpdafdiwgqgtmvtvssast
    kgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtatytcnvdhkpsntkvdkrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqdB (B:)
    qvqlvqsgaevkkpgasvkvsckvsgytltelpvhwvrqapgkglewvgsfdpesgesiy
    arefqgsvtmtadtstniaymelsslrsddtavyycavpdpdafdiwgqgtmvtvssast
    kgpsvfplataalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvt
    atytcnvdhkpsntkvdkrv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqdC (C:)
    csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd
    fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
    vncldpplltrylrihpqswvhqialrmevlgceaq