PDB entry 1iqd

View 1iqd on RCSB PDB site
Description: Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.
Deposited on 2001-07-21, released 2001-08-15
The last revision prior to the SCOP 1.71 freeze date was dated 2001-08-15, with a file datestamp of 2001-08-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iqdA (A:)
    ialtqspgtlslspgeratlscrasqsfsssylawyqqkpgqaprlliygastratgipd
    rfsgsgsgtdftltisrlepedfavyycqkygtsaitfgqgtrleikgtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqdA (A:)
    ialtqspgtlslspgeratlscrasqsfsssylawyqqkpgqaprlliygastratgipd
    rfsgsgsgtdftltisrlepedfavyycqkygtsaitfgqgtrleikgtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglvtksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iqdB (B:)
    qvqlvqsgaevkkpgasvkvsckvsgytltelpvhwvrqapgkglewvgsfdpesgesiy
    arefqgsvtmtadtstniaymelsslrsddtavyycavpdpdafdiwgqgtmvtvssast
    kgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtatytcnvdhkpsntkvdkrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqdB (B:)
    qvqlvqsgaevkkpgasvkvsckvsgytltelpvhwvrqapgkglewvgsfdpesgesiy
    arefqgsvtmtadtstniaymelsslrsddtavyycavpdpdafdiwgqgtmvtvssast
    kgpsvfplataalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvt
    atytcnvdhkpsntkvdkrv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqdC (C:)
    csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd
    fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
    vncldpplltrylrihpqswvhqialrmevlgceaq