PDB entry 1iqc

View 1iqc on RCSB PDB site
Description: crystal structure of di-heme peroxidase from nitrosomonas europaea
Deposited on 2001-07-20, released 2002-01-20
The last revision prior to the SCOP 1.61 freeze date was dated 2002-01-20, with a file datestamp of 2002-01-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.222
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqcA (A:)
    anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
    wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
    rerfkkvfgsdevtidrittaiaqfeetlvtpgskfdkwlegdknalnqdelegynlfkg
    sgcvqchngpavggssyqkmgvfkpyetknpaagrmdvtgneadrnvfkvptlrnielty
    pyfhdggaatleqavetmgriqlnrefnkdevskivaflktltgdqpdfklpilppsnnd
    tprsqpye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqcB (B:)
    anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
    wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
    rerfkkvfgsdevtidrittaiaqfeetlvtpgskfdkwlegdknalnqdelegynlfkg
    sgcvqchngpavggssyqkmgvfkpyetknpaagrmdvtgneadrnvfkvptlrnielty
    pyfhdggaatleqavetmgriqlnrefnkdevskivaflktltgdqpdfklpilppsnnd
    tprsqpye
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqcC (C:)
    anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
    wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
    rerfkkvfgsdevtidrittaiaqfeetlvtpgskfdkwlegdknalnqdelegynlfkg
    sgcvqchngpavggssyqkmgvfkpyetknpaagrmdvtgneadrnvfkvptlrnielty
    pyfhdggaatleqavetmgriqlnrefnkdevskivaflktltgdqpdfklpilppsnnd
    tprsqpye
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqcD (D:)
    anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
    wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
    rerfkkvfgsdevtidrittaiaqfeetlvtpgskfdkwlegdknalnqdelegynlfkg
    sgcvqchngpavggssyqkmgvfkpyetknpaagrmdvtgneadrnvfkvptlrnielty
    pyfhdggaatleqavetmgriqlnrefnkdevskivaflktltgdqpdfklpilppsnnd
    tprsqpye