PDB entry 1iqb

View 1iqb on RCSB PDB site
Description: Crystal Structure of Urtica dioica Agglutinin Isolectin I
Class: sugar binding protein
Keywords: two homologous hevein-like domains, zinc complex, homo-dimer, sugar binding protein
Deposited on 2001-07-15, released 2001-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: agglutinin isolectin I
  Species: Urtica dioica [TaxId:3501]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11218 (0-88)
    • modified residue (0)
  Domains in SCOPe 2.07: d1iqba1, d1iqba2
• Chain 'B':
  Compound: agglutinin isolectin I
  Species: Urtica dioica [TaxId:3501]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11218 (0-88)
    • modified residue (0)
  Domains in SCOPe 2.07: d1iqbb1, d1iqbb2
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iqbA (A:)
  ercgsqggggtcpalwccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
  drccsvhgwcgggndycsgskcqyrcsss
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iqbB (B:)
  ercgsqggggtcpalwccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
  drccsvhgwcgggndycsgskcqyrcsss