PDB entry 1iqb

View 1iqb on RCSB PDB site
Description: Crystal Structure of Urtica dioica Agglutinin Isolectin I
Class: sugar binding protein
Keywords: two homologous hevein-like domains, zinc complex, homo-dimer, sugar binding protein
Deposited on 2001-07-15, released 2001-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin isolectin I
    Species: Urtica dioica [TaxId:3501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1iqba1, d1iqba2
  • Chain 'B':
    Compound: agglutinin isolectin I
    Species: Urtica dioica [TaxId:3501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1iqbb1, d1iqbb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqbA (A:)
    ercgsqggggtcpalwccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsgskcqyrcsss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqbB (B:)
    ercgsqggggtcpalwccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsgskcqyrcsss