PDB entry 1iq7

View 1iq7 on RCSB PDB site
Description: Ovotransferrin, C-Terminal Lobe, Apo Form
Class: metal transport
Keywords: transferrin, ovotransferrin, iron binding protein, transport protein, metal transport
Deposited on 2001-07-06, released 2001-11-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovotransferrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1iq7a_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iq7A (A:)
    enriqwcavgkdekskcdrwsvvsngdvectvvdetkdciikimkgeadavaldgglvyt
    agvcglvpvmaeryddesqcsktderpasyfavavarkdsnvnwnnlkgkkschtavgrt
    agwvipmglihnrtgtcnfdeyfsegcapgsppnsrlcqlcqgsggippekcvassheky
    fgytgalrclvekgdvafiqhstveentggknkadwaknlqmddfellctdgrranvmdy
    recnlaevpthavvvrpekankirdllerqekrfgvngsekskfmmfesqnkdllfkdlt
    kclfkvregttykeflgdkfytvisslktcnpsdilqmcsflegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iq7A (A:)
    riqwcavgkdekskcdrwsvvsngdvectvvdetkdciikimkgeadavaldgglvytag
    vcglvpvmaeryddescskderpasyfavavarkdsnvnwnnlkgkkschtavgrtagwv
    ipmglihnrtgtcnfdeyfsegcapgsppnsrlcqlcqgsggippekcvasshekyfgyt
    galrclvekgdvafiqhstveentggknkadwaknlqmddfellctdgrranvmdyrecn
    laevpthavvvrpekankirdllerqekrfgvngsekskfmmfesqnkdllfkdltkclf
    kvregttykeflgdkfytvisslktcnpsdilqmcsflegk