PDB entry 1iq4

View 1iq4 on RCSB PDB site
Description: 5s-rRNA binding ribosomal protein l5 from bacillus stearothermophilus
Class: RNA binding protein
Keywords: Ribosomal protein, rRNA-binding, RNP motif, RNA BINDING PROTEIN
Deposited on 2001-06-13, released 2001-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.215
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L5
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08895 (0-178)
      • engineered (8-9)
      • engineered (110)
      • engineered (120)
    Domains in SCOPe 2.06: d1iq4a_
  • Chain 'B':
    Compound: 50S ribosomal protein L5
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08895 (0-178)
      • engineered (8-9)
      • engineered (110)
      • engineered (120)
    Domains in SCOPe 2.06: d1iq4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iq4A (A:)
mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli
agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk
sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iq4B (B:)
mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli
agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk
sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk