PDB entry 1iq4

View 1iq4 on RCSB PDB site
Description:
Deposited on 2001-06-13, released 2001-06-27
The last revision prior to the SCOP 1.71 freeze date was dated 2001-06-27, with a file datestamp of 2001-06-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.215
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1iq4a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1iq4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iq4A (A:)
    mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli
    agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk
    sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iq4B (B:)
    mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli
    agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk
    sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk