PDB entry 1iq3

View 1iq3 on RCSB PDB site
Description: solution structure of the eps15 homology domain of a human pob1
Deposited on 2001-06-06, released 2001-06-27
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-27, with a file datestamp of 2001-06-27.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1iq3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iq3A (A:)
    gslqdnssypdepwriteeqreyyvnqfrslqpdpssfisgsvaknfftksklsipelsy
    iwelsdadcdgaltlpefcaafhlivarkngyplpeglpptlqpefivtd