PDB entry 1iq2

View 1iq2 on RCSB PDB site
Description: Solution structure of a novel disintegrin, salmosin from Agkistrodon halys venom
Class: toxin
Keywords: Solution structure, Disintegrin, Salmosin, TOXIN
Deposited on 2001-05-31, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet aggregation inhibitor disintegrin
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • GB AAC08997 (0-72)
    Domains in SCOPe 2.07: d1iq2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iq2A (A:)
    eageecdcgspgnpccdaatcklrqgaqcaeglccdqcrfmkegticrrargddlddycn
    gisagcprnpfha