PDB entry 1ipw

View 1ipw on RCSB PDB site
Description: inorganic pyrophosphatase from escherichia coli with three magnesium ions
Class: hydrolase
Keywords: soluble inorganic pyrophosphatase, hydrolase, magnesium
Deposited on 1996-03-04, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.171
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: soluble inorganic pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ipwa_
  • Chain 'B':
    Compound: soluble inorganic pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ipwb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ipwA (A:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ipwA (A:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdedaklvavphsklskeydhikdv
    ndlpellkaqiahffehykdlekwvkvegwenaeaakaeivasferak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ipwB (B:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ipwB (B:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferak