PDB entry 1ips

View 1ips on RCSB PDB site
Description: isopenicillin n synthase from aspergillus nidulans (manganese complex)
Deposited on 1997-03-21, released 1998-03-25
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-25, with a file datestamp of 1998-03-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ipsa_
  • Chain 'B':
    Domains in SCOP 1.55: d1ipsb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ipsA (A:)
    vskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhm
    sitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpt
    hevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlas
    vvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdie
    addtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepn
    gksdreplsygdylqnglvslinkngqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ipsB (B:)
    vskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhm
    sitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpt
    hevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlas
    vvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdie
    addtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepn
    gksdreplsygdylqnglvslinkngqt