PDB entry 1ipp

View 1ipp on RCSB PDB site
Description: homing endonuclease/DNA complex
Class: transcription/DNA
Keywords: homing endonuclease, intron, zinc, DNA binding, protein folding, transcription/DNA
Deposited on 1998-03-19, released 1998-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intron-encoded endonuclease I-ppoi
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ippa_
  • Chain 'B':
    Compound: intron-encoded endonuclease I-ppoi
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ippb_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*tp*gp*ap*cp*tp*cp*tp*cp*tp*tp*ap*ap*gp*ap*gp*ap*gp*tp*cp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*tp*gp*ap*cp*tp*cp*tp*cp*tp*tp*ap*ap*gp*ap*gp*ap*gp*tp*cp*a)-3')
  • Heterogens: CD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ippA (A:)
    maltnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngpt
    rwqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnk
    grnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ippA (A:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ippB (B:)
    maltnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngpt
    rwqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnk
    grnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ippB (B:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.