PDB entry 1ipk

View 1ipk on RCSB PDB site
Description: crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers
Deposited on 2001-05-16, released 2002-05-16
The last revision prior to the SCOP 1.69 freeze date was dated 2002-05-16, with a file datestamp of 2002-05-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ipkA (A:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kiiklaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ipkA (A:)
    nnpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillphha
    dadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkiiklai
    pvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfqegvivelskeqi
    rqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpqlrdldiflssvd
    inegalllphfnskaivilvinegdanielvgikeqplevqryraelseddvfvipaayp
    fvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaqdverllkkq
    resyfvda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ipkB (B:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kiiklaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ipkB (B:)
    npfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillphhad
    adfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkiiklaip
    vnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfqegvivelskeqir
    qlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpqlrdldiflssvdi
    negalllphfnskaivilvinegdanielvgikelevqryraelseddvfvipaaypfvv
    natsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaqdverllkkqres
    yfvda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ipkC (C:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kiiklaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ipkC (C:)
    vredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntil
    lphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlki
    iklaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeqrq
    qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp
    qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikplevqryraelse
    ddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgs
    aqdverllkkqresyfvda