PDB entry 1ipj

View 1ipj on RCSB PDB site
Description: crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers complexes with n-acetyl-d-glucosamine
Deposited on 2001-05-16, released 2002-05-16
The last revision prior to the SCOP 1.71 freeze date was dated 2002-05-16, with a file datestamp of 2002-05-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.202
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ipjA (A:)
    lkvredennpfylrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kiiklaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvllgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ipjA (A:)
    nnpfylrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillphha
    dadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkiiklai
    pvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvllgqqegvivelsak
    sssrktissedepfnlrsrnpiysnnfgkffeitpeknpqlrdldiflssvdinegalll
    phfnskaivilvinegdanielvgiklevqryraelseddvfvipaaypfvvnatsnlnf
    lafginaennqrnflagekdnvvrqierqvqelafpgsaqdverllkkqresyfvda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ipjB (B:)
    lkvredennpfylrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kiiklaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvllgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ipjB (B:)
    nnpfylrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillphha
    dadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkiiklai
    pvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvllgvivelskeqirq
    lsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpqlrdldiflssvdin
    egalllphfnskaivilvinegdanielvgiklevqryraelseddvfvipaaypfvvna
    tsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaqdverllkkqresyf
    vda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ipjC (C:)
    lkvredennpfylrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kiiklaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvllgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ipjC (C:)
    nnpfylrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillphha
    dadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkiiklai
    pvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvllgeqrqqegvivel
    skeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpqlrdldif
    lssvdinegalllphfnskaivilvinegdanielvgievqryraelseddvfvipaayp
    fvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaqdverllkkq
    resyfvda