PDB entry 1ipd

View 1ipd on RCSB PDB site
Description: three-dimensional structure of a highly thermostable enzyme, 3- isopropylmalate dehydrogenase of thermus thermophilus at 2.2 angstroms resolution
Deposited on 1992-01-29, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ipd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ipd_ (-)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkispetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatvlrhla