PDB entry 1ipa

View 1ipa on RCSB PDB site
Description: crystal structure of rna 2'-o ribose methyltransferase
Deposited on 2001-05-02, released 2002-07-10
The last revision prior to the SCOP 1.71 freeze date was dated 2002-07-10, with a file datestamp of 2002-07-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ipaA (A:)
    mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpe
    eqqvyaalgrvgrlallevseavlkklsvrdnpaglialarmpertleeyrpspdalilv
    avglekpgnlgavlrsadaagaeavlvaggvdlyspqvirnstgvvfslrtlaasesevl
    dwikqhnlplvattphaealyweanlrppvaiavgpeheglraawleaaqtqvripmqgq
    adslnvsvsaalllyealrqrllrdrltkthstl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ipaA (A:)
    mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpe
    eqqvyaallallevseavlkklsvrdnpaglialarmpertleeyrpspdalilvavgle
    kpgnlgavlrsadaagaeavlvaggvdlyspqvirnstgvvfslrtlaasesevldwikq
    hnlplvattphaealyweanlrppvaiavgpeheglraawleaaqtqvripmqgqadsln
    vsvsaalllyealrqrll