PDB entry 1ip9

View 1ip9 on RCSB PDB site
Description: solution structure of the pb1 domain of bem1p
Deposited on 2001-04-26, released 2001-08-15
The last revision prior to the SCOP 1.69 freeze date was dated 2001-08-15, with a file datestamp of 2001-08-15.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1ip9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ip9A (A:)
  gamgsstsglkttkikfyykddifalmlkgdttykelrskiapridtdnfklqtklfdgs
  geeiktdsqvsniiqaklkisvhdi