PDB entry 1iow

View 1iow on RCSB PDB site
Description: complex of y216f d-ala:d-ala ligase with ADP and a phosphoryl phosphinate
Class: ligase
Keywords: glycogen phosphorylase, ligase, cell wall, peptidoglycan synthesis, vancomycin, ADP binding
Deposited on 1996-09-20, released 1997-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.158
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-ala:d-ala ligase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07862 (1-305)
      • engineered (215)
    Domains in SCOPe 2.08: d1iowa1, d1iowa2
  • Heterogens: MG, ADP, PHY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iowA (A:)
mtdkiavllggtsaerevslnsgaavlaglreggidaypvdpkevdvtqlksmgfqkvfi
alhgrggedgtlqgmlelmglpytgsgvmasalsmdklrskllwqgaglpvapwvaltra
efekglsdkqlaeisalglpvivkpsregssvgmskvvaenalqdalrlafqhdeevlie
kwlsgpeftvailgeeilpsiriqpsgtfydyeakflsdetqyfcpagleasqeanlqal
vlkawttlgckgwgridvmldsdgqfylleantspgmtshslvpmaarqagmsfsqlvvr
ilelad