PDB entry 1iou

View 1iou on RCSB PDB site
Description: solution structure of ykt6p (1-140)
Class: membrane protein
Keywords: snare, membrane protein
Deposited on 2001-04-09, released 2003-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ykt6p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36015 (0-139)
      • conflict (54)
      • conflict (83)
    Domains in SCOPe 2.06: d1ioua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iouA (A:)
mriyyigvfrsggekalelsevkdlsqfgfferssvgqfmtffaetvasrtgagerqsie
egnyighvyarsegicgvlitdkqypvrpaytllnkildeylvahpkeewadvtetndal
kmkqldtyiskyqdpsqada