PDB entry 1iot

View 1iot on RCSB PDB site
Description: stabilization of hen egg white lysozyme by a cavity-filling mutation
Class: hydrolase
Keywords: hydrolase, Glycosidase, Bacteriolytic enzyme
Deposited on 2001-03-28, released 2001-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered (11)
    Domains in SCOPe 2.07: d1iota_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iotA (A:)
    kvfgrcelaaalkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl