PDB entry 1iok

View 1iok on RCSB PDB site
Description: crystal structure of chaperonin-60 from paracoccus denitrificans
Deposited on 2001-03-16, released 2001-10-03
The last revision prior to the SCOP 1.67 freeze date was dated 2001-10-03, with a file datestamp of 2001-10-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.204
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iokA (A:)
    maakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakei
    elsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgi
    dvatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveen
    kgmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesv
    iqsqkpllivaedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqv
    isedlgmklenvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdy
    dreklqervaklaggvavirvggmteievkerkdrvddalnatraavqegivvgggvalv
    qgakvleglsgansdqdagiaiirraleapmrqiaenagvdgavvagkvressdkafgfn
    aqteeygdmfkfgvidpakvvrtaledaasvagllitteamiaekpepkapaggmpdmgg
    mggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iokA (A:)
    aakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakeie
    lsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgid
    vatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveenk
    gmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivae
    dveiaavkapgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiea
    rvsqirqqieettsdydreklqervaklaggvavirvggmteievkerkdrvddalnatr
    aavqegivvgggvalvqgakvleglsgansdqdagiaiirraleapmrqiaenagvdgav
    vagkvressdkafgfnaqteeygdmfkfgvidpakvvrtaledaasvagllitteamiae
    kp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iokB (B:)
    maakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakei
    elsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgi
    dvatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveen
    kgmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesv
    iqsqkpllivaedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqv
    isedlgmklenvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdy
    dreklqervaklaggvavirvggmteievkerkdrvddalnatraavqegivvgggvalv
    qgakvleglsgansdqdagiaiirraleapmrqiaenagvdgavvagkvressdkafgfn
    aqteeygdmfkfgvidpakvvrtaledaasvagllitteamiaekpepkapaggmpdmgg
    mggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iokB (B:)
    aakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakeie
    lsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgid
    vatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveenk
    gmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivae
    dveiaavkapgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiea
    rvsqirqqieettsdydreklqervaklaggvavirvggmteievkerkdrvddalnatr
    aavqegivvgggvalvqgakvleglsgansdqdagiaiirraleapmrqiaenagvdgav
    vagkvressdkafgfnaqteeygdmfkfgvidpakvvrtaledaasvagllitteamiae
    kp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iokC (C:)
    maakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakei
    elsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgi
    dvatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveen
    kgmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesv
    iqsqkpllivaedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqv
    isedlgmklenvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdy
    dreklqervaklaggvavirvggmteievkerkdrvddalnatraavqegivvgggvalv
    qgakvleglsgansdqdagiaiirraleapmrqiaenagvdgavvagkvressdkafgfn
    aqteeygdmfkfgvidpakvvrtaledaasvagllitteamiaekpepkapaggmpdmgg
    mggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iokC (C:)
    aakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakeie
    lsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgid
    vatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveenk
    gmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivae
    dveiaavkapgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiea
    rvsqirqqieettsdydreklqervaklaggvavirvggmteievkerkdrvddalnatr
    aavqegivvgggvalvqgakvleglsgansdqdagiaiirraleapmrqiaenagvdgav
    vagkvressdkafgfnaqteeygdmfkfgvidpakvvrtaledaasvagllitteamiae
    kp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iokD (D:)
    maakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakei
    elsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgi
    dvatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveen
    kgmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesv
    iqsqkpllivaedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqv
    isedlgmklenvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdy
    dreklqervaklaggvavirvggmteievkerkdrvddalnatraavqegivvgggvalv
    qgakvleglsgansdqdagiaiirraleapmrqiaenagvdgavvagkvressdkafgfn
    aqteeygdmfkfgvidpakvvrtaledaasvagllitteamiaekpepkapaggmpdmgg
    mggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iokD (D:)
    aakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakeie
    lsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgid
    vatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveenk
    gmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivae
    dveiaavkapgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiea
    rvsqirqqieettsdydreklqervaklaggvavirvggmteievkerkdrvddalnatr
    aavqegivvgggvalvqgakvleglsgansdqdagiaiirraleapmrqiaenagvdgav
    vagkvressdkafgfnaqteeygdmfkfgvidpakvvrtaledaasvagllitteamiae
    kp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1iokE (E:)
    maakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakei
    elsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgi
    dvatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveen
    kgmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesv
    iqsqkpllivaedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqv
    isedlgmklenvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdy
    dreklqervaklaggvavirvggmteievkerkdrvddalnatraavqegivvgggvalv
    qgakvleglsgansdqdagiaiirraleapmrqiaenagvdgavvagkvressdkafgfn
    aqteeygdmfkfgvidpakvvrtaledaasvagllitteamiaekpepkapaggmpdmgg
    mggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iokE (E:)
    aakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakeie
    lsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgid
    vatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveenk
    gmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivae
    dveiaavkapgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiea
    rvsqirqqieettsdydreklqervaklaggvavirvggmteievkerkdrvddalnatr
    aavqegivvgggvalvqgakvleglsgansdqdagiaiirraleapmrqiaenagvdgav
    vagkvressdkafgfnaqteeygdmfkfgvidpakvvrtaledaasvagllitteamiae
    kp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1iokF (F:)
    maakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakei
    elsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgi
    dvatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveen
    kgmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesv
    iqsqkpllivaedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqv
    isedlgmklenvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdy
    dreklqervaklaggvavirvggmteievkerkdrvddalnatraavqegivvgggvalv
    qgakvleglsgansdqdagiaiirraleapmrqiaenagvdgavvagkvressdkafgfn
    aqteeygdmfkfgvidpakvvrtaledaasvagllitteamiaekpepkapaggmpdmgg
    mggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iokF (F:)
    aakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakeie
    lsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgid
    vatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveenk
    gmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivae
    dveiaavkapgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiea
    rvsqirqqieettsdydreklqervaklaggvavirvggmteievkerkdrvddalnatr
    aavqegivvgggvalvqgakvleglsgansdqdagiaiirraleapmrqiaenagvdgav
    vagkvressdkafgfnaqteeygdmfkfgvidpakvvrtaledaasvagllitteamiae
    kp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1iokG (G:)
    maakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakei
    elsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgi
    dvatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveen
    kgmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesv
    iqsqkpllivaedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqv
    isedlgmklenvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdy
    dreklqervaklaggvavirvggmteievkerkdrvddalnatraavqegivvgggvalv
    qgakvleglsgansdqdagiaiirraleapmrqiaenagvdgavvagkvressdkafgfn
    aqteeygdmfkfgvidpakvvrtaledaasvagllitteamiaekpepkapaggmpdmgg
    mggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iokG (G:)
    aakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakeie
    lsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgid
    vatakvveaiksaarpvndssevaqvgtisangesfigqqiaeamqrvgnegvitveenk
    gmetevevvegmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivae
    dveiaavkapgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiea
    rvsqirqqieettsdydreklqervaklaggvavirvggmteievkerkdrvddalnatr
    aavqegivvgggvalvqgakvleglsgansdqdagiaiirraleapmrqiaenagvdgav
    vagkvressdkafgfnaqteeygdmfkfgvidpakvvrtaledaasvagllitteamiae
    kp