PDB entry 1ioi

View 1ioi on RCSB PDB site
Description: x-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant
Deposited on 2001-03-09, released 2001-03-21
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ioia_
  • Chain 'B':
    Domains in SCOP 1.57: d1ioib_
  • Chain 'C':
    Domains in SCOP 1.57: d1ioic_
  • Chain 'D':
    Domains in SCOP 1.57: d1ioid_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ioiA (A:)
    mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
    pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
    mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
    gqvppsmsyemeleavkvaievaleell
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ioiB (B:)
    mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
    pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
    mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
    gqvppsmsyemeleavkvaievaleell
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ioiC (C:)
    mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
    pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
    mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
    gqvppsmsyemeleavkvaievaleell
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ioiD (D:)
    mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
    pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
    mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
    gqvppsmsyemeleavkvaievaleell