PDB entry 1iod

View 1iod on RCSB PDB site
Description: crystal structure of the complex between the coagulation factor x binding protein from snake venom and the gla domain of factor x
Class: hydrolase/hydrolase inhibitor
Keywords: calcium bridging, domain swapping, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2001-02-27, released 2001-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: coagulation factor x binding protein
  Species: Deinagkistrodon acutus [TaxId:36307]
  Database cross-references and differences (RAF-indexed):
  • PDB 1IOD (0-128)
  Domains in SCOPe 2.06: d1ioda_
• Chain 'B':
  Compound: coagulation factor x binding protein
  Species: Deinagkistrodon acutus [TaxId:36307]
  Database cross-references and differences (RAF-indexed):
  • PDB 1IOD (0-122)
  Domains in SCOPe 2.06: d1iodb_
• Chain 'G':
  Compound: coagulation factor x gla domain
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00743 (0-43)
  Domains in SCOPe 2.06: d1iodg_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iodA (A:)
  dcssgwssyeghcykvfkqsktwadaesfctkqvngghlvsiessgeadfvgqliaqkik
  sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce
  qqdpfvcea
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iodB (B:)
  dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
  ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
  fqa
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iodG (G:)
  ansfleevkqgnlerecleeacsleearevfedaeqtdefwsky